Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat PHLPI protein

This Rat PHLPI protein spans the amino acid sequence from region 24-263aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Phl p I Allergen, Phl p 1

UniProt

P43213

Expression Region

24-263aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Phleum pratense (Common timothy)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEAL1 (NM_004780) Human Recombinant Protein
E45H34821M5 20 µg

TCEAL1 (NM_004780) Human Recombinant Protein

Sign In for Pricing
View Details
Cefoperazone 30 µg
7170 5x 50 Discs

Cefoperazone 30 µg

Sign In for Pricing
View Details
PRKAB1 Knockout Cell Lysate
ABC-KC1572 100 µg

PRKAB1 Knockout Cell Lysate

Sign In for Pricing
View Details
MSRB3 Rabbit Monoclonal Antibody
AMRe84049-01 1 Each

MSRB3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MSRB3 Rabbit Monoclonal Antibody
AMRe84049-02 50 µL

MSRB3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MSRB3 Rabbit Monoclonal Antibody
AMRe84049-03 100 µL

MSRB3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details