Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat PHLPI protein

This Rat PHLPI protein spans the amino acid sequence from region 24-263aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Phl p I Allergen, Phl p 1

UniProt

P43213

Expression Region

24-263aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Phleum pratense (Common timothy)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Vacuolar fusion protein MON1 homolog A(MON1A), partial
AP71384-01 20 µg

Recombinant Human Vacuolar fusion protein MON1 homolog A(MON1A), partial

Sign In for Pricing
View Details
Recombinant Human Vacuolar fusion protein MON1 homolog A(MON1A), partial
AP71384-02 100 µg

Recombinant Human Vacuolar fusion protein MON1 homolog A(MON1A), partial

Sign In for Pricing
View Details
Recombinant Human Vacuolar fusion protein MON1 homolog A(MON1A), partial
AP71384-03 1 mg

Recombinant Human Vacuolar fusion protein MON1 homolog A(MON1A), partial

Sign In for Pricing
View Details
3-Chloro-4-fluoro-DL-phenylglycine
sc-298980 1 g

3-Chloro-4-fluoro-DL-phenylglycine

Sign In for Pricing
View Details
PE/AF594 Anti-Human CD90 Antibody
RD30338F-01 20 Tests

PE/AF594 Anti-Human CD90 Antibody

Sign In for Pricing
View Details
PE/AF594 Anti-Human CD90 Antibody
RD30338F-02 100 Tests

PE/AF594 Anti-Human CD90 Antibody

Sign In for Pricing
View Details