Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat PHLPI protein

This Rat PHLPI protein spans the amino acid sequence from region 24-263aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Phl p I Allergen, Phl p 1

UniProt

P43213

Expression Region

24-263aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Phleum pratense (Common timothy)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-Tryptamine
5-02215 1 g

Boc-Tryptamine

Sign In for Pricing
View Details
MEM (Richter's Modification) (without phenol red)
PM150473 500 mL

MEM (Richter's Modification) (without phenol red)

Sign In for Pricing
View Details
Recombinant Human FXL17 (His)
BP3679-500ug 500 µg

Recombinant Human FXL17 (His)

Sign In for Pricing
View Details
OBFC1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
32407154 3x 1.0 µg DNA

OBFC1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Anti-Napsin A (Lung Adenocarcinoma Marker) Monoclonal Antibody (Clone: NAPSA/1238)
36-3599-100 100 µg

Anti-Napsin A (Lung Adenocarcinoma Marker) Monoclonal Antibody (Clone: NAPSA/1238)

Sign In for Pricing
View Details
Amino (3-phenoxyphenyl) acetic acid
ZLA16894-01 250 mg

Amino (3-phenoxyphenyl) acetic acid

Sign In for Pricing
View Details