Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant PRO1 protein

This Plant PRO1 protein spans the amino acid sequence from region 2-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pollen allergen Cyn d 12 Allergen, Cyn d 12

UniProt

O04725

Expression Region

2-131aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Cynodon dactylon (Bermuda grass) (Panicum dactylon)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIEKLGDYLIEQGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-[4- (Trifluoromethyl) phenyl]pyrrolidin-3-amine
BQB75531-01 50 mg

1-[4- (Trifluoromethyl) phenyl]pyrrolidin-3-amine

Sign In for Pricing
View Details
1-[4- (Trifluoromethyl) phenyl]pyrrolidin-3-amine
BQB75531-02 0.5 g

1-[4- (Trifluoromethyl) phenyl]pyrrolidin-3-amine

Sign In for Pricing
View Details
E.coli, HRP conjugated
orb3002094 100 µL

E.coli, HRP conjugated

Sign In for Pricing
View Details
Sheep 2-Oxohistidine ELISA Kit
MBS7266368-01 48 Well

Sheep 2-Oxohistidine ELISA Kit

Sign In for Pricing
View Details
Sheep 2-Oxohistidine ELISA Kit
MBS7266368-02 96 Well

Sheep 2-Oxohistidine ELISA Kit

Sign In for Pricing
View Details
Sheep 2-Oxohistidine ELISA Kit
MBS7266368-03 5x 96 Well

Sheep 2-Oxohistidine ELISA Kit

Sign In for Pricing
View Details