Plant BETVII protein
This Plant BETVII protein spans the amino acid sequence from region 2-133aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Allergen Bet v II Pollen allergen Bet v 2 Allergen, Bet v 2
UniProt
P25816
Expression Region
2-133aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Betula pendula (European white birch) (Betula verrucosa)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
30.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6400744-01 0.1 mL
Glypican 3 (Glypican-3, GPC3, DGSX, GTR2-2, Intestinal Protein OCI-5, MXR7, OCI5, OCI-5, SDYS, SGB, SGBS, SGBS1) (MaxLight 750)
Sign In for Pricing
View Details MBS6400744-02 5x 0.1 mL
Glypican 3 (Glypican-3, GPC3, DGSX, GTR2-2, Intestinal Protein OCI-5, MXR7, OCI5, OCI-5, SDYS, SGB, SGBS, SGBS1) (MaxLight 750)
Sign In for Pricing
View Details 
MBS1288342 Inquire
Recombinant Oryza sativa subsp. japonica Laccase-12/13 (LAC12), partial
Sign In for Pricing
View Details A06852-APC 100 µg/Vial
Anti-AMOTL2 Antibody Picoband® (APC Conjugate)
Sign In for Pricing
View Details 