Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant BETVII protein

This Plant BETVII protein spans the amino acid sequence from region 2-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Bet v II Pollen allergen Bet v 2 Allergen, Bet v 2

UniProt

P25816

Expression Region

2-133aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Betula pendula (European white birch) (Betula verrucosa)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vigabatrin
C14347-5mg 5 mg

Vigabatrin

Sign In for Pricing
View Details
CNOT1 Protein Vector (Human) (pPM-C-His)
PV070156 500 ng

CNOT1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SLC16A5 Human shRNA Lentiviral Particle (Locus ID 9121)
TL309402V 500 µL Each

SLC16A5 Human shRNA Lentiviral Particle (Locus ID 9121)

Sign In for Pricing
View Details
SORL1 Protein Lysate (Mouse) with C-HA Tag
45121034 100 µg

SORL1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Rat 26S proteasome non-ATPase regulatory subunit 1 (Psmd1) , partial
MBS1032341 Inquire

Recombinant Rat 26S proteasome non-ATPase regulatory subunit 1 (Psmd1) , partial

Sign In for Pricing
View Details
3-Fluoro-4- (2-methoxyphenoxy) benzoic acid
425573-01 100 mg

3-Fluoro-4- (2-methoxyphenoxy) benzoic acid

Sign In for Pricing
View Details