What is the catalog number for Bacterial lasB protein?

The catalog number for Bacterial lasB protein is orb358686.

What sizes are available for Bacterial lasB protein?

Bacterial lasB protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bacterial lasB protein come in?

Bacterial lasB protein is available in 3 different pack sizes.

Is Bacterial lasB protein in stock?

Bacterial lasB protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bacterial lasB protein

This Bacterial lasB protein spans the amino acid sequence from region 198-498aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neutral metalloproteinase PAE Pseudolysin Cleaved into the following chain, Pro-elastase

UniProt

P14756

Expression Region

198-498aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL