Human gB protein
This Human gB protein spans the amino acid sequence from region 23-260aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
GP115 Glycoprotein GP110
UniProt
P03188
Expression Region
23-260aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Field of Research
Epigenetics, Infectious Diseases, Non-Animal
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
43.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QTPEQPAPPATTVQPTATRQQTSFPFRVCELSSHGDLFRFSSDIQCPSFGTRENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGWYADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGWLIWTYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6496260-01 0.1 mL
PKLR, NT (Pyruvate Kinase Isozymes R/L, Pyruvate Kinase 1, R-type/L-type Pyruvate Kinase, Red Cell/Liver Pyruvate Kinase, PK1, PKL) (MaxLight 490)
Sign In for Pricing
View Details MBS6496260-02 5x 0.1 mL
PKLR, NT (Pyruvate Kinase Isozymes R/L, Pyruvate Kinase 1, R-type/L-type Pyruvate Kinase, Red Cell/Liver Pyruvate Kinase, PK1, PKL) (MaxLight 490)
Sign In for Pricing
View Details 
130336-ML490 100 µL
NFIX (Nuclear Factor 1 X-type, NF1-X, Nuclear Factor 1/X, CCAAT-box-binding Transcription Factor, CTF, Nuclear Factor I/X, NF-I/X, NFI-X, TGGCA-binding Protein) (MaxLight 490)
Sign In for Pricing
View Details 