Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human gB protein

This Human gB protein spans the amino acid sequence from region 23-260aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GP115 Glycoprotein GP110

UniProt

P03188

Expression Region

23-260aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QTPEQPAPPATTVQPTATRQQTSFPFRVCELSSHGDLFRFSSDIQCPSFGTRENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGWYADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGWLIWTYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIN2 (Bridging Integrator 2, BRAP-1, Breast cancer-associated protein 1)
362282 200 µL

BIN2 (Bridging Integrator 2, BRAP-1, Breast cancer-associated protein 1)

Sign In for Pricing
View Details
Monoclonal Antibody to Immunoglobulin G (IgG)
TRV-0033956-01 20 µL

Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
Monoclonal Antibody to Immunoglobulin G (IgG)
TRV-0033956-02 100 µL

Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
Monoclonal Antibody to Immunoglobulin G (IgG)
TRV-0033956-03 200 µL

Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
Monoclonal Antibody to Immunoglobulin G (IgG)
TRV-0033956-04 1 mL

Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
NOS1 Antibody
orb671300-01 50 µg

NOS1 Antibody

Sign In for Pricing
View Details