Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLURP1 protein

This Human SLURP1 protein spans the amino acid sequence from region 23-103aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ARS component B ARS (component B) -81/S Anti-neoplastic urinary protein Short name, ANUP

UniProt

P55000

Expression Region

23-103aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FAP Protein, His-tagged, Alexa Fluor 647 conjugated
FAP-1141HAF647 20 μg- 50 μg- 100 μg

Recombinant Human FAP Protein, His-tagged, Alexa Fluor 647 conjugated

Sign In for Pricing
View Details
Ki-67 Mouse mAb, PE-Cy7 conjugated
orb3000391 100 µL

Ki-67 Mouse mAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Human Vascular Endothelial Growth Factor (121), Sf9
CG125-010 10 µg

Recombinant Human Vascular Endothelial Growth Factor (121), Sf9

Sign In for Pricing
View Details
SKP1 Rabbit Polyclonal Antibody
AP20271PU-N 100 µg

SKP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATF6 beta Rabbit Polyclonal Antibody (BF700)
orb2533373 100 µL

ATF6 beta Rabbit Polyclonal Antibody (BF700)

Sign In for Pricing
View Details
GW568377A
T27510-01 25 mg

GW568377A

Sign In for Pricing
View Details