Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Pla l 1 protein

This Plant Pla l 1 protein spans the amino acid sequence from region 1-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen, Pla l 1

UniProt

P82242

Expression Region

1-131aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Plantago lanceolata (English plantain) (Ribwort plantain)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETDQDGVYRLPVVGYHEDCEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAKTDAPGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10-Undecenoic Acid
TRC-U788820-250G 250 g

10-Undecenoic Acid

Sign In for Pricing
View Details
NAPSIN-A Antibody
KC-2513-01 50 μL

NAPSIN-A Antibody

Sign In for Pricing
View Details
NAPSIN-A Antibody
KC-2513-02 100 µL

NAPSIN-A Antibody

Sign In for Pricing
View Details
NAPSIN-A Antibody
KC-2513-03 1 mL

NAPSIN-A Antibody

Sign In for Pricing
View Details
Human S100 calcium binding protein A14 (S100A14) activation kit by CRISPRa
GA111479 1 Kit

Human S100 calcium binding protein A14 (S100A14) activation kit by CRISPRa

Sign In for Pricing
View Details
N-AcetyIglucosamine BSA Colloidal Gold Conjugate, 1mL 30nm
CCG-0005-30 1 mL

N-AcetyIglucosamine BSA Colloidal Gold Conjugate, 1mL 30nm

Sign In for Pricing
View Details