Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Pla l 1 protein

This Plant Pla l 1 protein spans the amino acid sequence from region 1-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen, Pla l 1

UniProt

P82242

Expression Region

1-131aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Plantago lanceolata (English plantain) (Ribwort plantain)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETDQDGVYRLPVVGYHEDCEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAKTDAPGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cd81 activation kit by CRISPRa
GA200639 1 Kit

Mouse Cd81 activation kit by CRISPRa

Sign In for Pricing
View Details
CEBPE Antibody
8C11104-AAT 50 µg

CEBPE Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09742J-01 20 Tests

PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09742J-02 100 Tests

PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09742J-03 2x 100 Tests

PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
Fmoc-Val Wang Resin LL
HLL0751501327.25G 25 g

Fmoc-Val Wang Resin LL

Sign In for Pricing
View Details