Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Rhesus macaque

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Rhesus macaque consists of 153 amino acids (A117-S269) and is expressed in E. coli.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Rhesus macaque, Rhesus Macaque, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-rhesus-macaque.html

Purity

98.0

Smiles

APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVSS

Molecular Formula

704701 (Gene_ID) P48090 (A117-S269) (Accession)

Molecular Weight

Approximately 18.4 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Anti-Human HNRNPD pAb
PA11703-01 50 μL

Rabbit Anti-Human HNRNPD pAb

Ask
View Details
Rabbit Anti-Human HNRNPD pAb
PA11703-02 100 μL

Rabbit Anti-Human HNRNPD pAb

Ask
View Details
ATP5H Antibody (Center)
MBS9207414-01 0.08 mL

ATP5H Antibody (Center)

Ask
View Details
ATP5H Antibody (Center)
MBS9207414-02 0.4 mL

ATP5H Antibody (Center)

Ask
View Details
ATP5H Antibody (Center)
MBS9207414-03 5x 0.4 mL

ATP5H Antibody (Center)

Ask
View Details
Human FAM181B siRNA
abx916163-01 15 nmol

Human FAM181B siRNA

Ask
View Details