What is the catalog number for Plant Cor a 1 protein?

The catalog number for Plant Cor a 1 protein is orb358664.

What sizes are available for Plant Cor a 1 protein?

Plant Cor a 1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Plant Cor a 1 protein come in?

Plant Cor a 1 protein is available in 3 different pack sizes.

Is Plant Cor a 1 protein in stock?

Plant Cor a 1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Plant Cor a 1 protein

This Plant Cor a 1 protein spans the amino acid sequence from region 2-160aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Cor a I Allergen, Cor a 1

UniProt

Q08407

Expression Region

2-160aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Corylus avellana (European hazel) (Corylus maxima)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN