Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial albA protein

This Bacterial albA protein spans the amino acid sequence from region 1-93aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AlbA, PF1881DNA/RNA-binding protein Alba

UniProt

Q8TZV1

Expression Region

1-93aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3 η Antibody
34146-01 50 µL

14-3-3 η Antibody

Sign In for Pricing
View Details
14-3-3 η Antibody
34146-02 100 µL

14-3-3 η Antibody

Sign In for Pricing
View Details
Jak3 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6848503 1.0 µg DNA

Jak3 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Tibulizumab ELISA Kit
MBS1564822-01 96 Tests

Tibulizumab ELISA Kit

Sign In for Pricing
View Details
Tibulizumab ELISA Kit
MBS1564822-02 5x 96 Tests

Tibulizumab ELISA Kit

Sign In for Pricing
View Details
GM130 GOLGA2 Mouse Monoclonal Antibody (FITC)
orb2609750 100 µg

GM130 GOLGA2 Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details