Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial uvsY protein

This Bacterial uvsY protein spans the amino acid sequence from region 1-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UvsY, Recombination protein uvsY

UniProt

P04537

Expression Region

1-137aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Endo-1,4-beta-xylanase C (xynC), partial
MBS1057798 Inquire

Recombinant Endo-1,4-beta-xylanase C (xynC), partial

Sign In for Pricing
View Details
(S) -Cyclopentyl (dimethylphosphoryl) methanamine hydrochloride
TTD96438-01 50 mg

(S) -Cyclopentyl (dimethylphosphoryl) methanamine hydrochloride

Sign In for Pricing
View Details
(S) -Cyclopentyl (dimethylphosphoryl) methanamine hydrochloride
TTD96438-02 0.5 g

(S) -Cyclopentyl (dimethylphosphoryl) methanamine hydrochloride

Sign In for Pricing
View Details
KATNB1 Antibody
orb1267458 400 μl

KATNB1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal ORC1 Antibody (ORC1 7F6/1) [Janelia Fluor 669]
NB100-121JF669 0.1 mL

Mouse Monoclonal ORC1 Antibody (ORC1 7F6/1) [Janelia Fluor 669]

Sign In for Pricing
View Details
Amtn Rat shRNA Lentiviral Particle (Locus ID 689404)
TL703746V 500 µL Each

Amtn Rat shRNA Lentiviral Particle (Locus ID 689404)

Sign In for Pricing
View Details