Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial uvsY protein

This Bacterial uvsY protein spans the amino acid sequence from region 1-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UvsY, Recombination protein uvsY

UniProt

P04537

Expression Region

1-137aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBEGF Rabbit pAb, PE-Cy7 conjugated
orb2864531 100 µL

HBEGF Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Mouse Monoclonal CD163 Antibody (rM130/8820) [Janelia Fluor 525]
NBP3-24230JF525 0.1 mL

Mouse Monoclonal CD163 Antibody (rM130/8820) [Janelia Fluor 525]

Sign In for Pricing
View Details
Icosl 3'UTR Lenti-reporter-Luc Vector
24155084 1.0 µg

Icosl 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RPS5 (Ribosomal Protein S5) (MaxLight 550)
251279-ML550 100 µL

RPS5 (Ribosomal Protein S5) (MaxLight 550)

Sign In for Pricing
View Details
Ntn1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
32246116 3x 1.0 µg

Ntn1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Fmoc-S-xanthyl-L-cysteine
277406-01 2 g

Fmoc-S-xanthyl-L-cysteine

Sign In for Pricing
View Details