Human CXCR2 protein
This Human CXCR2 protein spans the amino acid sequence from region 1-40aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
CDw128b GRO/MGSA receptor High affinity interleukin-8 receptor B Short name, IL-8R B IL-8 receptor type 2 CD_antigen, CD182
UniProt
P25025
Expression Region
1-40aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
031295-ML650 100 µL
TLE4, ID (TLE4, KIAA1261, Transducin-like enhancer protein 4) (MaxLight 650) discontinued
Sign In for Pricing
View Details 
MBS2802456-01 48 Tests
Donkey B-cell CLL/lymphoma 2 (BCL2) ELISA Kit
Sign In for Pricing
View Details MBS2802456-02 96 Tests
Donkey B-cell CLL/lymphoma 2 (BCL2) ELISA Kit
Sign In for Pricing
View Details MBS2802456-03 5x 96 Tests
Donkey B-cell CLL/lymphoma 2 (BCL2) ELISA Kit
Sign In for Pricing
View Details