Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Allergen Phl p Vb protein

This Rat Allergen Phl p Vb protein spans the amino acid sequence from region 20-284aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Phl p Vb Allergen, Phl p 5b

UniProt

Q40963

Expression Region

20-284aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Phleum pratense (Common timothy)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), 0.2mg/mL
BNUB2491-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), 0.2mg/mL

Sign In for Pricing
View Details
IRF3 (NM_001197123) Human Over-expression Lysate
LY434202 100 µg

IRF3 (NM_001197123) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse GFRA2/GFRα2/GDNFRB Protein (His Tag)
PKSM040829 100 µg

Recombinant Mouse GFRA2/GFRα2/GDNFRB Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Joint
CS627815 5x 5 µm

Frozen Tissue Sections, Joint

Sign In for Pricing
View Details
Anti-Human Lambda Antibody
KC-1650-01 50 μL

Anti-Human Lambda Antibody

Sign In for Pricing
View Details
Anti-Human Lambda Antibody
KC-1650-02 100 µL

Anti-Human Lambda Antibody

Sign In for Pricing
View Details