Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial zapA protein

This Bacterial zapA protein spans the amino acid sequence from region 1-85aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Z ring-associated protein ZapA

UniProt

A8FG14

Expression Region

1-85aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bacillus pumilus (strain SAFR-032)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDGGKTKTTVEIYGQSYTIIGQETKMHMRHVASIVDDKMREINEKNPYLDINKLAVLTAVNVVHDYLKLKEQYEKLEIQLKEKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EID2 Human shRNA Plasmid Kit (Locus ID 163126)
TL318037 1 Kit

EID2 Human shRNA Plasmid Kit (Locus ID 163126)

Sign In for Pricing
View Details
CEP55 Rabbit Polyclonal Antibody (APC)
orb2657336 100 µg

CEP55 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Pigeon High-Temperature Requirement Factor A3 ELISA Kit
MBS064424 Inquire

Pigeon High-Temperature Requirement Factor A3 ELISA Kit

Sign In for Pricing
View Details
Human Alpha Synuclein oligomer ELISA kit
GTR10408614 96 Well

Human Alpha Synuclein oligomer ELISA kit

Sign In for Pricing
View Details
Recombinant Human YWHAE Protein, Untagged, E.coli-20ug
QP13985-20ug 20ug

Recombinant Human YWHAE Protein, Untagged, E.coli-20ug

Sign In for Pricing
View Details
PCMTD1 siRNA (Human)
CRJ4440-01 15 nmol

PCMTD1 siRNA (Human)

Sign In for Pricing
View Details