Bacterial zapA protein
This Bacterial zapA protein spans the amino acid sequence from region 1-85aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Z ring-associated protein ZapA
UniProt
A8FG14
Expression Region
1-85aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Bacillus pumilus (strain SAFR-032)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
25.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSDGGKTKTTVEIYGQSYTIIGQETKMHMRHVASIVDDKMREINEKNPYLDINKLAVLTAVNVVHDYLKLKEQYEKLEIQLKEKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
I7661-05-ML750 100 µL
Insulin-Like Growth Factor I (IGF1, Somatomedin C) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
038577-ML405 100 µL
MRAP2, ID (MRAP2, C6orf117, Melanocortin-2 receptor accessory protein 2) (MaxLight 405) discontinued
Sign In for Pricing
View Details MBS6135562-01 0.1 mL
BTG2 (Protein BTG2, BTG Family Member 2, PC3, NGF-inducible Anti-proliferative Protein PC3, MGC126063, MGC126064, TIS21) APC
Sign In for Pricing
View Details MBS6135562-02 5x 0.1 mL
BTG2 (Protein BTG2, BTG Family Member 2, PC3, NGF-inducible Anti-proliferative Protein PC3, MGC126063, MGC126064, TIS21) APC
Sign In for Pricing
View Details