What is the catalog number for Human ZNRF3 protein?

The catalog number for Human ZNRF3 protein is orb358647.

What sizes are available for Human ZNRF3 protein?

Human ZNRF3 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human ZNRF3 protein come in?

Human ZNRF3 protein is available in 3 different pack sizes.

Is Human ZNRF3 protein in stock?

Human ZNRF3 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human ZNRF3 protein

This Human ZNRF3 protein spans the amino acid sequence from region 56-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RING finger protein 203 Zinc/RING finger protein 3

UniProt

Q9ULT6

Expression Region

56-219aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM