Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli tir protein

This E. coli tir protein spans the amino acid sequence from region 252-362aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secreted effector protein Tir

UniProt

C6UYL8

Expression Region

252-362aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli O157:H7 (strain TW14359 / EHEC)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELKVSSGAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC5L Antibody
CSB-PA080082-01 50 µg

CDC5L Antibody

Sign In for Pricing
View Details
CDC5L Antibody
CSB-PA080082-02 100 µg

CDC5L Antibody

Sign In for Pricing
View Details
Trehalose 6-behenate
orb1706059-01 25 mg

Trehalose 6-behenate

Sign In for Pricing
View Details
Trehalose 6-behenate
orb1706059-02 50 mg

Trehalose 6-behenate

Sign In for Pricing
View Details
Trehalose 6-behenate
orb1706059-03 100 mg

Trehalose 6-behenate

Sign In for Pricing
View Details
SMYD3-IT1 Protein Vector (Human) (pPB-C-His)
PV130490 500 ng

SMYD3-IT1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details