Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACLY protein

This Human ACLY protein spans the amino acid sequence from region 4-265aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP-citrate (pro-S-) -lyase Short name, ACL Citrate cleavage enzyme

UniProt

P53396

Expression Region

4-265aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGK1 Human Gene Knockout Kit (CRISPR)
KN411172 1 Kit

PGK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat Crossover junction endonuclease EME1 (EME1) ELISA Kit
MBS7205143-01 48 Well

Rat Crossover junction endonuclease EME1 (EME1) ELISA Kit

Sign In for Pricing
View Details
Rat Crossover junction endonuclease EME1 (EME1) ELISA Kit
MBS7205143-02 96 Well

Rat Crossover junction endonuclease EME1 (EME1) ELISA Kit

Sign In for Pricing
View Details
Rat Crossover junction endonuclease EME1 (EME1) ELISA Kit
MBS7205143-03 5x 96 Well

Rat Crossover junction endonuclease EME1 (EME1) ELISA Kit

Sign In for Pricing
View Details
Rat Crossover junction endonuclease EME1 (EME1) ELISA Kit
MBS7205143-04 10x 96 Well

Rat Crossover junction endonuclease EME1 (EME1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human DES1-3 IGF-1 Protein
NBP2-61314-5mg 5 mg

Recombinant Human DES1-3 IGF-1 Protein

Sign In for Pricing
View Details