Bacterial rplL protein
This Bacterial rplL protein spans the amino acid sequence from region 1-122aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
RplL, SAV0540, 50S ribosomal protein L7/L12
UniProt
P66061
Expression Region
1-122aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
28.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVELK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15153087 1 Vial
Lentiviral human TH shRNA (UAS) - Lentiviral human TH shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
M1201-53D1-ML490 100 µL
Macrophage Derived Chemokine (MDC, MDC (1-69), A-152E5.1, ABCD-1, CC Chemokine STCP-1, C-C Motif Chemokine 22, Chemokine (C-C Motif) Ligand 22, CCL22, DC/B-CK, MGC34554, Small Inducible Cytokine A22, SCYA22, Stimulated T-cell Chemotactic Protein 1, STCP-1) (MaxLight 490) discontinued. See M1201-52
Sign In for Pricing
View Details