Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey GPX4 protein

This Monkey GPX4 protein spans the amino acid sequence from region 1-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glutathione peroxidase 4 Short name, GPx-4 Short name, GSHPx-4

UniProt

Q4AEH2

Expression Region

1-170aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Ongo pygmaeus (Bornean orangutan)

Field of Research

Developmental Biology, Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LARP7 Antibody (FITC)
orb515931-01 50 µg

LARP7 Antibody (FITC)

Sign In for Pricing
View Details
LARP7 Antibody (FITC)
orb515931-02 100 µg

LARP7 Antibody (FITC)

Sign In for Pricing
View Details
Consortin Lentiviral Activation Particles (m)
sc-432652-LAC 200 µL

Consortin Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Angiotensin Converting Enzyme Inhibitor
E-PP-0678-01 10 mg

Angiotensin Converting Enzyme Inhibitor

Sign In for Pricing
View Details
Angiotensin Converting Enzyme Inhibitor
E-PP-0678-02 100 mg

Angiotensin Converting Enzyme Inhibitor

Sign In for Pricing
View Details
Angiotensin Converting Enzyme Inhibitor
E-PP-0678-03 5 mg

Angiotensin Converting Enzyme Inhibitor

Sign In for Pricing
View Details