What is the catalog number for Monkey GPX4 protein?

The catalog number for Monkey GPX4 protein is orb358637.

What sizes are available for Monkey GPX4 protein?

Monkey GPX4 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Monkey GPX4 protein come in?

Monkey GPX4 protein is available in 3 different pack sizes.

Is Monkey GPX4 protein in stock?

Monkey GPX4 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Monkey GPX4 protein

This Monkey GPX4 protein spans the amino acid sequence from region 1-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glutathione peroxidase 4 Short name, GPx-4 Short name, GSHPx-4

UniProt

Q4AEH2

Expression Region

1-170aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Ongo pygmaeus (Bornean orangutan)

Field of Research

Developmental Biology, Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI