Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Defb1 protein

This Mouse Defb1 protein spans the amino acid sequence from region 33-69aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, BD-1 Short name, mBD-1

UniProt

P56386

Expression Region

33-69aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Checkpoint Protein HUS1B (HUS1B) ELISA Kit
MBS7264584-01 48 Well

Chicken Checkpoint Protein HUS1B (HUS1B) ELISA Kit

Sign In for Pricing
View Details
Chicken Checkpoint Protein HUS1B (HUS1B) ELISA Kit
MBS7264584-02 96 Well

Chicken Checkpoint Protein HUS1B (HUS1B) ELISA Kit

Sign In for Pricing
View Details
Chicken Checkpoint Protein HUS1B (HUS1B) ELISA Kit
MBS7264584-03 5x 96 Well

Chicken Checkpoint Protein HUS1B (HUS1B) ELISA Kit

Sign In for Pricing
View Details
Chicken Checkpoint Protein HUS1B (HUS1B) ELISA Kit
MBS7264584-04 10x 96 Well

Chicken Checkpoint Protein HUS1B (HUS1B) ELISA Kit

Sign In for Pricing
View Details
PPFIBP2 AAV Vector (Human) (CMV)
37317101 1 µg

PPFIBP2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Prednisolone 21-Hemisuccinate
FP41786-01 50 g

Prednisolone 21-Hemisuccinate

Sign In for Pricing
View Details