Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Defb1 protein

This Mouse Defb1 protein spans the amino acid sequence from region 33-69aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, BD-1 Short name, mBD-1

UniProt

P56386

Expression Region

33-69aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal HGD Antibody (7O8Q1)
NBP3-15477-100ul 100 µL

Rabbit Monoclonal HGD Antibody (7O8Q1)

Sign In for Pricing
View Details
Endothelin-3 (human, mouse, rabbit, rat)
4013291.05 0.5 mg

Endothelin-3 (human, mouse, rabbit, rat)

Sign In for Pricing
View Details
Rpl36 Antibody
orb841952 2 mg

Rpl36 Antibody

Sign In for Pricing
View Details
Anti-Von Willebrand Factor/VWF Antibody (Dylight488 Conjugate)
A00270-1-Dylight488 100 µg

Anti-Von Willebrand Factor/VWF Antibody (Dylight488 Conjugate)

Sign In for Pricing
View Details
GENLISA™ Human Vascular Endothelial Growth Factor B (VEGFB) ELISA
KBH0133 1x 96 Well

GENLISA™ Human Vascular Endothelial Growth Factor B (VEGFB) ELISA

Sign In for Pricing
View Details
Wnt1 Rabbit Polyclonal Antibody (PerCP)
orb2444445 100 µL

Wnt1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details