Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Defb1 protein

This Mouse Defb1 protein spans the amino acid sequence from region 33-69aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, BD-1 Short name, mBD-1

UniProt

P56386

Expression Region

33-69aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Klhl2 shRNA (UAS) - Lentiviral mouse Klhl2 shRNA (UAS, iRFP) (25)
GTR15177014 1 Vial

Lentiviral mouse Klhl2 shRNA (UAS) - Lentiviral mouse Klhl2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ORF007L (NC_003494) Virus Tagged ORF Clone
VC102297 10 µg

ORF007L (NC_003494) Virus Tagged ORF Clone

Sign In for Pricing
View Details
EIF2B3 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-14537R-BF350 100 µL

EIF2B3 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
SOS1 Recombinant Antibody, Cy3 Conjugated
bsm-61476R-Cy3-01 20 µL

SOS1 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
SOS1 Recombinant Antibody, Cy3 Conjugated
bsm-61476R-Cy3-02 100 µL

SOS1 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Rabbit anti-GAP43 (pS41) Antibody
YLD3309-01 50 µL

Rabbit anti-GAP43 (pS41) Antibody

Sign In for Pricing
View Details