Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Nucleoprotein protein

This Viral Nucleoprotein protein spans the amino acid sequence from region 1-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein Short name, Protein N

UniProt

P21700

Expression Region

1-245aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rift valley fever virus (strain ZH-548 M12) (RVFV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC11A Rabbit Polyclonal Antibody
TA370306 100 µL

SEC11A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human RSL1D1 activation kit by CRISPRa
GA108781 1 Kit

Human RSL1D1 activation kit by CRISPRa

Sign In for Pricing
View Details
FAM90A9P Human Gene Knockout Kit (CRISPR)
KN428379 1 Kit

FAM90A9P Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Esculin
TRC-E658850-25G 25 g

Esculin

Sign In for Pricing
View Details
SPNS3 Human Gene Knockout Kit (CRISPR)
KN416345 1 Kit

SPNS3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P70 S6 Kinase (Ab-421) Antibody
8B7190-AAT 50 µg

P70 S6 Kinase (Ab-421) Antibody

Sign In for Pricing
View Details