Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Nucleoprotein protein

This Viral Nucleoprotein protein spans the amino acid sequence from region 1-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein Short name, Protein N

UniProt

P21700

Expression Region

1-245aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rift valley fever virus (strain ZH-548 M12) (RVFV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM177 (NM_001105198) Human Over-expression Lysate
LC426222 20 µg

TMEM177 (NM_001105198) Human Over-expression Lysate

Sign In for Pricing
View Details
CCDC88C (NM_001080414) Human Over-expression Lysate
LC421631 20 µg

CCDC88C (NM_001080414) Human Over-expression Lysate

Sign In for Pricing
View Details
NUCKS1 Human Gene Knockout Kit (CRISPR)
KN401704 1 Kit

NUCKS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MRPS5 Rabbit Polyclonal Antibody
TA370377 100 µL

MRPS5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCR5 Human Recombinant Protein, Synthetic Nanodisc
TP721467M 100 µg

CCR5 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
Vaccenic Acid Chloride
TRC-V070003-250MG 250 mg

Vaccenic Acid Chloride

Sign In for Pricing
View Details