Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Nucleoprotein protein

This Viral Nucleoprotein protein spans the amino acid sequence from region 1-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein Short name, Protein N

UniProt

P21700

Expression Region

1-245aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rift valley fever virus (strain ZH-548 M12) (RVFV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary
CS700184 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
HDAC1 (C-term) Rabbit Polyclonal Antibody
AP11121PU-N 400 µL

HDAC1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ASS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C4]
TA809122BM 100 µL

ASS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C4]

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS500928 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
VC DNA Ladder Mix, 5 x 50µg
NL1418 5 x 50μg

VC DNA Ladder Mix, 5 x 50µg

Sign In for Pricing
View Details
NDUFC2 Rabbit Polyclonal Antibody
TA379018 100 µL

NDUFC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details