Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ywhaz protein

This Mouse Ywhaz protein spans the amino acid sequence from region 1-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein kinase C inhibitor protein 1 Short name, KCIP-1 SEZ-2

UniProt

P63101

Expression Region

1-245aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TFAP4 shRNA (UAS) - Lentiviral human TFAP4 shRNA (UAS, RFP) plasmid
GTR15119653 1 Vial

Lentiviral human TFAP4 shRNA (UAS) - Lentiviral human TFAP4 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rat Peroxiredoxin 2/Prdx2 Recombinant Protein
PROTP35704-100ug 100 µg

Rat Peroxiredoxin 2/Prdx2 Recombinant Protein

Sign In for Pricing
View Details
HNMT Antibody (Ascites)
orb2997175-01 50 µL

HNMT Antibody (Ascites)

Sign In for Pricing
View Details
HNMT Antibody (Ascites)
orb2997175-02 100 µL

HNMT Antibody (Ascites)

Sign In for Pricing
View Details
ISL1, ID (ISL1, Insulin gene enhancer protein ISL-1)
037121 200 µL

ISL1, ID (ISL1, Insulin gene enhancer protein ISL-1)

Sign In for Pricing
View Details
Cleaved-Caspase-1 (D210) Polyclonal Antibody
MBS9414811-01 0.05 mL

Cleaved-Caspase-1 (D210) Polyclonal Antibody

Sign In for Pricing
View Details