Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Lgals4 protein

This Rat Lgals4 protein spans the amino acid sequence from region 1-324aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

L-36 lactose-binding protein Short name, L36LBP Lactose-binding lectin 4

UniProt

P38552

Expression Region

1-324aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akap12 Mouse Gene Knockout Kit (CRISPR)
KN501064 1 Kit

Akap12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SERINC3 Human Gene Knockout Kit (CRISPR)
KN402866 1 Kit

SERINC3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF320 (NM_207333) Human Over-expression Lysate
LY403960 100 µg

ZNF320 (NM_207333) Human Over-expression Lysate

Sign In for Pricing
View Details
CHN 1 (CHN1) Human Gene Knockout Kit (CRISPR)
KN402095 1 Kit

CHN 1 (CHN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CRLF2 Mouse Monoclonal Antibody [Clone ID: AT4E7]
AM50056PU-S 50 µL

CRLF2 Mouse Monoclonal Antibody [Clone ID: AT4E7]

Sign In for Pricing
View Details
Bempedoic Acid-d5
TRC-B119701-50MG 50 mg

Bempedoic Acid-d5

Sign In for Pricing
View Details