Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi HSP70 protein

This Fungi HSP70 protein spans the amino acid sequence from region 1-152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen, Alt a 3

UniProt

P78983

Expression Region

1-152aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Alternaria alternata (Alternaria rot fungus) (Torula alternata)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DI-8-ANEPPS
#61012 1x 5 mg

DI-8-ANEPPS

Sign In for Pricing
View Details
SP140 Human Gene Knockout Kit (CRISPR)
KN415894 1 Kit

SP140 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C21ORF56 (SPATC1L) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G5]
TA504612AM 100 µL

C21ORF56 (SPATC1L) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G5]

Sign In for Pricing
View Details
STAT4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H6]
TA502940AM 100 µL

STAT4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H6]

Sign In for Pricing
View Details
Mouse Zdhhc6 activation kit by CRISPRa
GA207064 1 Kit

Mouse Zdhhc6 activation kit by CRISPRa

Sign In for Pricing
View Details
Human DR3/TNFRSF25 Recombinant Rabbit monoclonal Antibody
HA723871B 100 µL

Human DR3/TNFRSF25 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details