Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi HSP70 protein

This Fungi HSP70 protein spans the amino acid sequence from region 1-152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen, Alt a 3

UniProt

P78983

Expression Region

1-152aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Alternaria alternata (Alternaria rot fungus) (Torula alternata)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Naphthylacetonitrile
TRC-N377810-500MG 500 mg

2-Naphthylacetonitrile

Sign In for Pricing
View Details
USP24 Recombinant Rabbit Monoclonal Antibody [JE56-50]
HA720022 100 µL

USP24 Recombinant Rabbit Monoclonal Antibody [JE56-50]

Sign In for Pricing
View Details
QuantiChrom™ Iron Assay Kit
DIFE-250 250 Tests

QuantiChrom™ Iron Assay Kit

Sign In for Pricing
View Details
Human FNDC4 activation kit by CRISPRa
GA112165 1 Kit

Human FNDC4 activation kit by CRISPRa

Sign In for Pricing
View Details
Tyrosine Hydroxylase (TH) Human Gene Knockout Kit (CRISPR)
KN211218LP 1 Kit

Tyrosine Hydroxylase (TH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CT47A6 activation kit by CRISPRa
GA118903 1 Kit

Human CT47A6 activation kit by CRISPRa

Sign In for Pricing
View Details