Insect Alpha-insect toxin LqhaIT protein
This Insect Alpha-insect toxin LqhaIT protein spans the amino acid sequence from region 20-85aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Lqh-alpha-IT Short name, Alpha-IT
UniProt
P17728
Expression Region
20-85aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Leiurus quinquestriatus hebraeus (Yellow scorpion)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
23.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC050017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470977-100 1x 100 µL
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880197-100 1x 100 µL
FOXP3 (FXP3/197), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882003-100 1x 100 µL
CD8b, Mouse (H35-17.2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742409-500 1x 500 µL
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details