Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cryopyrin protein

This Mouse Cryopyrin protein spans the amino acid sequence from region 1-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AGTAVPRL protein, C1orf7 protein, Caterpiller protein 1.1 protein, CIAS 1 protein, CIAS1 protein, FCAS protein, FCU protein, MWS protein, NACHT protein, NALP 3 protein, NALP3 protein, NLRP3 protein, PYPAF 1 protein, PYPAF1 protein, PYRIN containing APAF1 like protein 1 protein

UniProt

Q8R4B8

Expression Region

1-153aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics, Immunology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccr1l1 Mouse shRNA Lentiviral Particle (Locus ID 12770)
TL513555V 500 µL Each

Ccr1l1 Mouse shRNA Lentiviral Particle (Locus ID 12770)

Sign In for Pricing
View Details
Human NPRC/NPR3 (NP_001191304) VersaClone cDNA
RDC1956 10 µg

Human NPRC/NPR3 (NP_001191304) VersaClone cDNA

Sign In for Pricing
View Details
PG 931 Peptide
orb1473260-01 1 mg

PG 931 Peptide

Sign In for Pricing
View Details
PG 931 Peptide
orb1473260-02 5 mg

PG 931 Peptide

Sign In for Pricing
View Details
PG 931 Peptide
orb1473260-03 10 mg

PG 931 Peptide

Sign In for Pricing
View Details
Recombinant Human Serpin B6/Placental Thrombin Inhibitor (N-Trx, 6His)
CE54-10ug 10 µg

Recombinant Human Serpin B6/Placental Thrombin Inhibitor (N-Trx, 6His)

Sign In for Pricing
View Details