Mouse Cryopyrin protein

AGTAVPRL protein, C1orf7 protein, Caterpiller protein 1.1 protein, CIAS 1 protein, CIAS1 protein, FCAS protein, FCU protein, MWS protein, NACHT protein, NALP 3 protein, NALP3 protein, NLRP3 protein, PYPAF 1 protein, PYPAF1 protein, PYRIN containing APAF1 like protein 1 protein

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR