Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TUBB4A protein

This Human TUBB4A protein spans the amino acid sequence from region 1-444aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tubulin 5 beta Tubulin beta-4 chain

UniProt

P04350

Expression Region

1-444aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Exportin 5 (XPO5) activation kit by CRISPRa
GA111548 1 Kit

Human Exportin 5 (XPO5) activation kit by CRISPRa

Sign In for Pricing
View Details
HSP60 (GROEL/730), CF568 conjugate, 0.1mg/mL
BNC680730-500 1x 500 µL

HSP60 (GROEL/730), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KCNK18 (NM_181840) Human Over-expression Lysate
LY403632 100 µg

KCNK18 (NM_181840) Human Over-expression Lysate

Sign In for Pricing
View Details
GPR172B Polyclonal Antibody
E-AB-13279-01 20 µL

GPR172B Polyclonal Antibody

Sign In for Pricing
View Details
GPR172B Polyclonal Antibody
E-AB-13279-02 60 µL

GPR172B Polyclonal Antibody

Sign In for Pricing
View Details
GPR172B Polyclonal Antibody
E-AB-13279-03 120 µL

GPR172B Polyclonal Antibody

Sign In for Pricing
View Details