Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial rgpB protein

This Bacterial rgpB protein spans the amino acid sequence from region 230-473aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Arg-gingipain Gingipain 2 RGP-2

UniProt

P95493

Expression Region

230-473aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Porphyromonas gingivalis (strain ATCC BAA-308 / W83)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proprotein Convertase 2, NT (PC2, KEX2 Like Endoprotease 2, KEX2-like Endoprotease 2, Neuroendocrine Convertase 2, NEC 2, NEC2, Prohormone Convertase 2, Proprotein Convertase Subtilisin/kexin Type 2, PC2, PCSK2, SPC2) (MaxLight 490)
MBS6494705-01 0.1 mL

Proprotein Convertase 2, NT (PC2, KEX2 Like Endoprotease 2, KEX2-like Endoprotease 2, Neuroendocrine Convertase 2, NEC 2, NEC2, Prohormone Convertase 2, Proprotein Convertase Subtilisin/kexin Type 2, PC2, PCSK2, SPC2) (MaxLight 490)

Sign In for Pricing
View Details
Proprotein Convertase 2, NT (PC2, KEX2 Like Endoprotease 2, KEX2-like Endoprotease 2, Neuroendocrine Convertase 2, NEC 2, NEC2, Prohormone Convertase 2, Proprotein Convertase Subtilisin/kexin Type 2, PC2, PCSK2, SPC2) (MaxLight 490)
MBS6494705-02 5x 0.1 mL

Proprotein Convertase 2, NT (PC2, KEX2 Like Endoprotease 2, KEX2-like Endoprotease 2, Neuroendocrine Convertase 2, NEC 2, NEC2, Prohormone Convertase 2, Proprotein Convertase Subtilisin/kexin Type 2, PC2, PCSK2, SPC2) (MaxLight 490)

Sign In for Pricing
View Details
TNFAIP3 Recombinant Antibody, FITC Conjugated
bsm-61300R-FITC-TR 20 µL

TNFAIP3 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
JMJD6 Antibody
orb75268 100 µL

JMJD6 Antibody

Sign In for Pricing
View Details
MRPS2 protein (His tag)
80R-3007 0.1 mg

MRPS2 protein (His tag)

Sign In for Pricing
View Details
Olfactory Marker Protein Rabbit Polyclonal Antibody (BF555)
orb2468048 100 µL

Olfactory Marker Protein Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details