Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial rgpB protein

This Bacterial rgpB protein spans the amino acid sequence from region 230-473aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Arg-gingipain Gingipain 2 RGP-2

UniProt

P95493

Expression Region

230-473aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Porphyromonas gingivalis (strain ATCC BAA-308 / W83)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Guanylyl cyclase-activating protein 1, Guca1a ELISA KIT
ELI-08473m 96 Tests

Mouse Guanylyl cyclase-activating protein 1, Guca1a ELISA KIT

Sign In for Pricing
View Details
Cell Cycle Assay Solution Deep Red, 50 tests
C548-10 50 Tests

Cell Cycle Assay Solution Deep Red, 50 tests

Sign In for Pricing
View Details
Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (ALPP/516) [Alexa Fluor 350]
NBP2-47991AF350 0.1 mL

Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (ALPP/516) [Alexa Fluor 350]

Sign In for Pricing
View Details
GPR105 (P2RY14) (C-term) rabbit polyclonal antibody, Aff - Purified
SP4179P 50 µg

GPR105 (P2RY14) (C-term) rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
CWF19L1 Antibody
MBS9429947-01 0.1 mL

CWF19L1 Antibody

Sign In for Pricing
View Details
CWF19L1 Antibody
MBS9429947-02 5x 0.1 mL

CWF19L1 Antibody

Sign In for Pricing
View Details