Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VPS13A protein

This Human VPS13A protein spans the amino acid sequence from region 3037-3140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chorea-acanthocytosis protein Chorein

UniProt

Q96RL7

Expression Region

3037-3140aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFXAP Polyclonal Antibody
MBS9131955-01 0.02 mL

RFXAP Polyclonal Antibody

Sign In for Pricing
View Details
RFXAP Polyclonal Antibody
MBS9131955-02 0.1 mL

RFXAP Polyclonal Antibody

Sign In for Pricing
View Details
RFXAP Polyclonal Antibody
MBS9131955-03 5x 0.1 mL

RFXAP Polyclonal Antibody

Sign In for Pricing
View Details
Human U6 snRNA-associated Sm-like protein LSm1, LSM1 ELISA Kit
MBS9317379-01 48 Well

Human U6 snRNA-associated Sm-like protein LSm1, LSM1 ELISA Kit

Sign In for Pricing
View Details
Human U6 snRNA-associated Sm-like protein LSm1, LSM1 ELISA Kit
MBS9317379-02 96 Well

Human U6 snRNA-associated Sm-like protein LSm1, LSM1 ELISA Kit

Sign In for Pricing
View Details
Human U6 snRNA-associated Sm-like protein LSm1, LSM1 ELISA Kit
MBS9317379-03 5x 96 Well

Human U6 snRNA-associated Sm-like protein LSm1, LSM1 ELISA Kit

Sign In for Pricing
View Details