Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VPS13A protein

This Human VPS13A protein spans the amino acid sequence from region 3037-3140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chorea-acanthocytosis protein Chorein

UniProt

Q96RL7

Expression Region

3037-3140aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal Goat anti-Mouse IgG (H+L) Secondary Antibody [FITC] (Pre-absorbed)
NBP1-71769 1 mg

Goat Polyclonal Goat anti-Mouse IgG (H+L) Secondary Antibody [FITC] (Pre-absorbed)

Sign In for Pricing
View Details
CITED1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV625760 1.0 µg DNA

CITED1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
OPALIN Antibody, Biotin conjugated
CSB-PA822279LD01HU-01 50 µg

OPALIN Antibody, Biotin conjugated

Sign In for Pricing
View Details
OPALIN Antibody, Biotin conjugated
CSB-PA822279LD01HU-02 100 µg

OPALIN Antibody, Biotin conjugated

Sign In for Pricing
View Details
Hmgb4 Rat shRNA Plasmid (Locus ID 685271)
TR707955 1 Kit

Hmgb4 Rat shRNA Plasmid (Locus ID 685271)

Sign In for Pricing
View Details
Ankyrin Repeat And MYND Domain Containing 2 (ANKMY2) Antibody
abx036799-01 100 µg

Ankyrin Repeat And MYND Domain Containing 2 (ANKMY2) Antibody

Sign In for Pricing
View Details