Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sap130 protein

This Mouse Sap130 protein spans the amino acid sequence from region 845-1057aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

130KDA Sin3-associated polypeptide Sin3-associated polypeptide p130

UniProt

Q8BIH0

Expression Region

845-1057aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adipokinetic Hormone II from Locusta migRatoria
MBS826426-01 1 mg

Adipokinetic Hormone II from Locusta migRatoria

Sign In for Pricing
View Details
Adipokinetic Hormone II from Locusta migRatoria
MBS826426-02 5 mg

Adipokinetic Hormone II from Locusta migRatoria

Sign In for Pricing
View Details
Adipokinetic Hormone II from Locusta migRatoria
MBS826426-03 10 mg

Adipokinetic Hormone II from Locusta migRatoria

Sign In for Pricing
View Details
Adipokinetic Hormone II from Locusta migRatoria
MBS826426-04 5x 10 mg

Adipokinetic Hormone II from Locusta migRatoria

Sign In for Pricing
View Details
GFAP Antibody
orb1312196 100 µL

GFAP Antibody

Sign In for Pricing
View Details
PRSS21 (Testisin, 3421-, Eosinophil Serine Protease 1, ESP-1, Serine Protease 21, PRSS21, ESP1, TEST1) (PE) discontinued
302675-PE 100 µL

PRSS21 (Testisin, 3421-, Eosinophil Serine Protease 1, ESP-1, Serine Protease 21, PRSS21, ESP1, TEST1) (PE) discontinued

Sign In for Pricing
View Details