Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DNASE1L3 protein

This Human DNASE1L3 protein spans the amino acid sequence from region 21-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNase I homolog protein DHP2 Deoxyribonuclease I-like 3 Short name, DNase I-like 3 Liver and spleen DNase Short name, LS-DNase Short name, LSD

UniProt

Q13609

Expression Region

21-305aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G-protein coupled Receptor family C group 6 member A (GPRC6A) Mouse ELISA Kit
D5590 96 Tests

G-protein coupled Receptor family C group 6 member A (GPRC6A) Mouse ELISA Kit

Sign In for Pricing
View Details
H-Nva-OMe · HCl
F-3495.0005 5.0g

H-Nva-OMe · HCl

Sign In for Pricing
View Details
Rabbit Anti Human EPHA6 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (Western Blot,IHC,ELISA) 200UL
IRBAMLEPHA6AAP32200UL 200 µL

Rabbit Anti Human EPHA6 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (Western Blot,IHC,ELISA) 200UL

Sign In for Pricing
View Details
Recombinant Chloroherpeton thalassium Thiazole synthase (thiG)
MBS1214286-01 0.02 mg (E-Coli)

Recombinant Chloroherpeton thalassium Thiazole synthase (thiG)

Sign In for Pricing
View Details
Recombinant Chloroherpeton thalassium Thiazole synthase (thiG)
MBS1214286-02 0.02 mg (Yeast)

Recombinant Chloroherpeton thalassium Thiazole synthase (thiG)

Sign In for Pricing
View Details
Recombinant Chloroherpeton thalassium Thiazole synthase (thiG)
MBS1214286-03 0.1 mg (E-Coli)

Recombinant Chloroherpeton thalassium Thiazole synthase (thiG)

Sign In for Pricing
View Details