Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial ompS1 protein

This Bacterial ompS1 protein spans the amino acid sequence from region 22-394aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OmpS1, ompS, STY2203, t0883, Outer membrane protein S1

UniProt

Q56110

Expression Region

22-394aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Salmonella typhi

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEIYNKNGNKLDLYGKVDGLRYFSDNAGDDGDQSYARIGFKGETQINDMLTGYGQWEYNIKVNTTEGEGANSWTRLGFAGLKFGEYGSFDYGRNYGVIYDIEAWTDALPEFGGDTYTQTDVYMLGRTNGVATYRNTDFFGLVEGLNFALQYQGNNENGGAGAGEGTGNGGNRKLARENGDGFGMSTSYDFDFGLSLGAAYSSSDRSDNQVARGYGDGMNERNNYAGGETAEAWTIGAKYDAYNVYLAAMYAETRNMTYYGGGNGEGNGSIANKTQNFEVVAQYQFDFGLRPSIAYLQSKGKDLGGQEVHRGNWRYTDKDLVKYVDVGMTYYFNKNMSTYVDYKINLLDEDDDFYANNGIATDDIVGVGLVYQF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Culture Medium for Human Colon Adenocarcinoma Cells [RKO]
AFG-ELL-1635-01 125 mL

Culture Medium for Human Colon Adenocarcinoma Cells [RKO]

Sign In for Pricing
View Details
Culture Medium for Human Colon Adenocarcinoma Cells [RKO]
AFG-ELL-1635-02 500 mL

Culture Medium for Human Colon Adenocarcinoma Cells [RKO]

Sign In for Pricing
View Details
IL17C Polyclonal Antibody, FITC Conjugated
bs-2611R-FITC 100 µL

IL17C Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Gill's Hematoxylin, III
GH33800 1 Gal

Gill's Hematoxylin, III

Sign In for Pricing
View Details
Mouse Monoclonal CD45RO Antibody (190-2F2.5) [Janelia Fluor 646]
NBP2-47956JF646 0.1 mL

Mouse Monoclonal CD45RO Antibody (190-2F2.5) [Janelia Fluor 646]

Sign In for Pricing
View Details
Recombinant Human CD300f/CD300LF Protein, C-His
EHJ28501 100 μg

Recombinant Human CD300f/CD300LF Protein, C-His

Sign In for Pricing
View Details