Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC1A6 protein

This Human SLC1A6 protein spans the amino acid sequence from region 149-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent glutamate/aspartate transporter Solute carrier family 1 member 6

UniProt

P48664

Expression Region

149-271aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Cyclobutyl-1H-pyrazole-4-carboxylic Acid
ZDC71835-01 50 mg

1-Cyclobutyl-1H-pyrazole-4-carboxylic Acid

Sign In for Pricing
View Details
1-Cyclobutyl-1H-pyrazole-4-carboxylic Acid
ZDC71835-02 0.5 g

1-Cyclobutyl-1H-pyrazole-4-carboxylic Acid

Sign In for Pricing
View Details
Alpha neoendorphin Rabbit pAb, BF700 conjugated
orb2863511 100 µL

Alpha neoendorphin Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
NF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV695966 1.0 µg DNA

NF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
BRWD3 siRNA (Mouse)
MBS8231860-01 15 nmol

BRWD3 siRNA (Mouse)

Sign In for Pricing
View Details
BRWD3 siRNA (Mouse)
MBS8231860-02 30 nmol

BRWD3 siRNA (Mouse)

Sign In for Pricing
View Details