Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC1A6 protein

This Human SLC1A6 protein spans the amino acid sequence from region 149-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent glutamate/aspartate transporter Solute carrier family 1 member 6

UniProt

P48664

Expression Region

149-271aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOAT2 Protein Vector (Rat) (pPM-C-His)
PV307245 500 ng

SOAT2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
TAPA1/Cd81 Rabbit Polyclonal Antibody (APC)
orb2613518 100 µg

TAPA1/Cd81 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Artemin Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-22202R-BF488 100 µL

Artemin Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Cytochrome p450 2J2 Rabbit Polyclonal Antibody (HRP)
orb471661 100 µL

Cytochrome p450 2J2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
FCRL3, CT (FCRL3, FCRH3, IFGP3, IRTA3, SPAP2, Fc receptor-like protein 3, Fc receptor homolog 3, IFGP family protein 3, Immune receptor translocation-associated protein 3, SH2 domain-containing phosphatase anchor protein 2, CD307c) (MaxLight 750)
MBS6298734-01 0.1 mL

FCRL3, CT (FCRL3, FCRH3, IFGP3, IRTA3, SPAP2, Fc receptor-like protein 3, Fc receptor homolog 3, IFGP family protein 3, Immune receptor translocation-associated protein 3, SH2 domain-containing phosphatase anchor protein 2, CD307c) (MaxLight 750)

Sign In for Pricing
View Details
FCRL3, CT (FCRL3, FCRH3, IFGP3, IRTA3, SPAP2, Fc receptor-like protein 3, Fc receptor homolog 3, IFGP family protein 3, Immune receptor translocation-associated protein 3, SH2 domain-containing phosphatase anchor protein 2, CD307c) (MaxLight 750)
MBS6298734-02 5x 0.1 mL

FCRL3, CT (FCRL3, FCRH3, IFGP3, IRTA3, SPAP2, Fc receptor-like protein 3, Fc receptor homolog 3, IFGP family protein 3, Immune receptor translocation-associated protein 3, SH2 domain-containing phosphatase anchor protein 2, CD307c) (MaxLight 750)

Sign In for Pricing
View Details